RetrogeneDB ID: | retro_dnov_104 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_1605:406607..406950(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000007983 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 59.48 % |
Parental protein coverage: | 62.16 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLA-GCLTKSSENGALPVVSVMRETESQLLPDVGA |
M.PP.R.C.PGERLC.LEEGS.G.GTY..H..IFS.LA..CL.K..E..A........E...Q.LP..G. | |
Retrocopy | MVPPTRDCLPGERLCHLEEGSLGRGTYAWHNDIFSLLA>SCLMKAAET-ACCLQRLGWERQPQVLPALGD |
Parental | IVTCKVSSINSRFAKVHILYVGSTPLKNSFRGTIRKEDVRATEKDK |
IV..KVSS.NS.FAKVHIL.VGSTPL.NSF.G.I..E..RATE.DK | |
Retrocopy | IVARKVSSTNSHFAKVHIL*VGSTPLENSF*GPIHMEGTRATEIDK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 6 .81 RPM |
SRP012922_cerebellum | 0 .00 RPM | 5 .91 RPM |
SRP012922_heart | 0 .00 RPM | 3 .25 RPM |
SRP012922_kidney | 0 .00 RPM | 4 .93 RPM |
SRP012922_liver | 0 .00 RPM | 3 .10 RPM |
SRP012922_lung | 0 .00 RPM | 7 .48 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 3 .81 RPM |
SRP012922_spleen | 0 .00 RPM | 8 .93 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000006477 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007983 | 1 retrocopy |
retro_dnov_104 ,
|
Erinaceus europaeus | ENSEEUG00000005647 | 3 retrocopies | |
Macropus eugenii | ENSMEUG00000002246 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000009228 | 1 retrocopy | |
Mus musculus | ENSMUSG00000034321 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000011898 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016259 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000003372 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000048708 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000006615 | 1 retrocopy |