RetrogeneDB ID: | retro_dnov_1395 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_19472:22625..22948(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RAP1B | ||
Ensembl ID: | ENSDNOG00000019724 | ||
Aliases: | None | ||
Description: | RAP1B, member of RAS oncogene family [Source:HGNC Symbol;Acc:9857] |
Percent Identity: | 82.57 % |
Parental protein coverage: | 69.03 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MREYKLVVLGSGG-VGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRD |
MRE.KLVVLGSGG..GKSALTVQ.VQGIFVEKYDP.IEDSYR.QVEVD.QQ.M..ILD.AGTEQFT.MRD | |
Retrocopy | MREHKLVVLGSGG<LGKSALTVQLVQGIFVEKYDPMIEDSYREQVEVDCQQRMFKILDIAGTEQFTVMRD |
Parental | LYMKNGKGFALVYSITAQSTFNDLQDLREQIL-RKDTDD |
LYMKNG.GFAL.YSITAQSTFN.LQDLR.QIL..KDT.D | |
Retrocopy | LYMKNGQGFALLYSITAQSTFNGLQDLRRQIL*VKDTED |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .97 RPM | 6 .81 RPM |
SRP012922_cerebellum | 0 .82 RPM | 1 .92 RPM |
SRP012922_heart | 0 .23 RPM | 1 .16 RPM |
SRP012922_kidney | 1 .10 RPM | 4 .38 RPM |
SRP012922_liver | 0 .46 RPM | 4 .33 RPM |
SRP012922_lung | 0 .61 RPM | 8 .25 RPM |
SRP012922_quadricep_muscle | 0 .69 RPM | 1 .38 RPM |
SRP012922_spleen | 1 .26 RPM | 15 .68 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008637 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000008272 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007809 | 5 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000015293 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000017413 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000019724 | 18 retrocopies | |
Erinaceus europaeus | ENSEEUG00000010052 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000000242 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000025649 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000016460 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000013148 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000011442 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000029552 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000005746 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000004751 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005197 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000007048 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000021148 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030014 | 2 retrocopies |