RetrogeneDB ID: | retro_dnov_200 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_2546:44548..44762(-) | ||
Located in intron of: | ENSDNOG00000017242 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPLP2 | ||
Ensembl ID: | ENSDNOG00000011513 | ||
Aliases: | None | ||
Description: | ribosomal protein, large, P2 [Source:HGNC Symbol;Acc:10377] |
Percent Identity: | 65.33 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | VISEL-NGKNIEDVIAQGIGKLASVPAGGAVAVAAAPGSAAPAASSAPAAAEEKKDEKKEESEESDDDMG |
V.SEL.NGKNI.D.I.QG.GK.A.V.A.G.VAVAAA..SAAPAASSA...AE.K.DEK.EE.....D.MG | |
Retrocopy | VVSEL>NGKNIDDGIDQGVGKVAGVTASGSVAVAAALSSAAPAASSALVTAEKKEDEKEEE---LGDKMG |
Parental | FGLFD |
F.LFD | |
Retrocopy | FDLFD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .39 RPM | 146 .43 RPM |
SRP012922_cerebellum | 0 .55 RPM | 56 .09 RPM |
SRP012922_heart | 0 .00 RPM | 86 .78 RPM |
SRP012922_kidney | 0 .27 RPM | 148 .40 RPM |
SRP012922_liver | 0 .00 RPM | 63 .47 RPM |
SRP012922_lung | 0 .31 RPM | 186 .17 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 121 .68 RPM |
SRP012922_spleen | 0 .11 RPM | 181 .08 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000001777 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000009523 | 1 retrocopy | |
Ciona intestinalis | ENSCING00000000626 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000011513 | 12 retrocopies | |
Felis catus | ENSFCAG00000008417 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020627 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026860 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000016296 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000002116 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000001056 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012842 | 1 retrocopy |