RetrogeneDB ID: | retro_dnov_2623 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_91629:145..427(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000017387 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 60.61 % |
| Parental protein coverage: | 78.81 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | KAGEQEKKLKDVFRQQQKI-FQQ-SRIIQSQRLKAFEKLHEQFMKSIED-MEKSHENLCAEAYRERKEEM |
| K.GEQEK.L.D.FR.QQK..FQQ..RIIQ.QRLKA..KL.EQF.KSI.D.MEKSHEN...EA..E.K.EM | |
| Retrocopy | KVGEQEKNLNDIFRWQQKT<FQQ<TRIIQRQRLKAIKKLYEQFIKSIKD>MEKSHENILIEA*GELK-EM |
| Parental | ALL-QKTIWMETQKQEMAVV--QKSLRSL |
| ALL.QKT.......Q...V...Q.SL.SL | |
| Retrocopy | ALL>QKTPHKLMETQQQEVAIFQQSLQSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 3 .31 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 37 .39 RPM |
| SRP012922_heart | 0 .00 RPM | 8 .82 RPM |
| SRP012922_kidney | 0 .00 RPM | 8 .21 RPM |
| SRP012922_liver | 0 .00 RPM | 1 .08 RPM |
| SRP012922_lung | 0 .00 RPM | 24 .74 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 3 .98 RPM |
| SRP012922_spleen | 0 .00 RPM | 10 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013389 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001658 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000001202 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017387 | 2 retrocopies |
retro_dnov_2623 , retro_dnov_739,
|
| Dasypus novemcinctus | ENSDNOG00000017624 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000007664 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010711 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000067764 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000072479 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000024543 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017224 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001853 | 1 retrocopy |