RetrogeneDB ID: | retro_dnov_739 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_103333:4198..4480(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000017387 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 60.61 % |
Parental protein coverage: | 78.81 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 4 |
Parental | KAGEQEKKLKDVFRQQQKI-FQQ-SRIIQSQRLKAFEKLHEQFMKSIED-MEKSHENLCAEAYRERKEEM |
K.GEQEK.L.D.FR.QQK..FQQ..RIIQ.QRLKA..KL.EQF.KSI.D.MEKSHEN...EA..E.K.EM | |
Retrocopy | KVGEQEKNLNDIFRWQQKT<FQQ<TRIIQRQRLKAIKKLYEQFIKSIKD>MEKSHENILIEA*GELK-EM |
Parental | ALL-QKTIWMETQKQEMAVV--QKSLRSL |
ALL.QKT.......Q...V...Q.SL.SL | |
Retrocopy | ALL>QKTPHKLMETQQQEVAIFQQSLQSL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 3 .31 RPM |
SRP012922_cerebellum | 0 .00 RPM | 37 .39 RPM |
SRP012922_heart | 0 .00 RPM | 8 .82 RPM |
SRP012922_kidney | 0 .00 RPM | 8 .21 RPM |
SRP012922_liver | 0 .00 RPM | 1 .08 RPM |
SRP012922_lung | 0 .00 RPM | 24 .74 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 3 .98 RPM |
SRP012922_spleen | 0 .00 RPM | 10 .19 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000013389 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000001658 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000001202 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000017387 | 2 retrocopies |
retro_dnov_2623, retro_dnov_739 ,
|
Dasypus novemcinctus | ENSDNOG00000017624 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000007664 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000010711 | 2 retrocopies | |
Mus musculus | ENSMUSG00000067764 | 1 retrocopy | |
Mus musculus | ENSMUSG00000072479 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000024543 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017224 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000001853 | 1 retrocopy |