RetrogeneDB ID: | retro_dnov_420 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_4544:178212..178558(+) | ||
| Located in intron of: | ENSDNOG00000006938 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000017624 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.17 % |
| Parental protein coverage: | 62.16 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 5 |
| Parental | EVHNMLERFGADI-NKTLLAKRKRLEVYTKASLKTSNQKIEHFWKVQQEQRQ-KLNQEYSQQFLTLFQQW |
| EV.N.LERF..DI.NK.LLAKRKRLE..TKASLKTSNQKI.H.WK.QQEQRQ.KLNQEYSQQFLTLFQQW | |
| Retrocopy | EVQNVLERFRTDI>NKALLAKRKRLEMFTKASLKTSNQKIGHVWKAQQEQRQ<KLNQEYSQQFLTLFQQW |
| Parental | EVDVQKAEEQEE-KLANIFRQQ-QKIFQQSRIVQSQRLKAIKQ-LYEQFV |
| ..DVQKAEEQ.E.KLA..F.QQ.QK.FQ.SRIV...R.K..KQ.L.EQF. | |
| Retrocopy | DTDVQKAEEQKE<KLASTF*QQ>QKVFQ*SRIV*R*RMKIMKQ>LCEQFL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 1 .36 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 13 .06 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .70 RPM |
| SRP012922_kidney | 0 .00 RPM | 0 .55 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .00 RPM |
| SRP012922_lung | 0 .00 RPM | 1 .83 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 0 .00 RPM |
| SRP012922_spleen | 0 .00 RPM | 2 .75 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013389 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001658 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000001202 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017387 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000017624 | 3 retrocopies |
retro_dnov_2294, retro_dnov_2402, retro_dnov_420 ,
|
| Echinops telfairi | ENSETEG00000007664 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010711 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000067764 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000072479 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000024543 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017224 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001853 | 1 retrocopy |