RetrogeneDB ID: | retro_dnov_410 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_4470:161357..161651(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TIPIN | ||
Ensembl ID: | ENSDNOG00000003177 | ||
Aliases: | None | ||
Description: | TIMELESS interacting protein [Source:HGNC Symbol;Acc:30750] |
Percent Identity: | 73.79 % |
Parental protein coverage: | 63.92 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | RTVKRNIPKLDAQRLISERGLPALRHVFDKAKFKGR-GHEAEDLKTLIRHMEHWAHRLFPKLQFEDFINR |
R..KRNI..LDAQRLISER..P.LRHVFD.AKFKG...HEA..LK.LIRH.E.WAHRLFPKL.FEDFIN. | |
Retrocopy | RAIKRNITNLDAQRLISEREFPILRHVFDTAKFKGG<RHEADNLKILIRHIEPWAHRLFPKL*FEDFIN- |
Parental | VEYLGNKKEVQTCLKRIR-LDLPVLHDDFISNN |
....GNKKEVQTCLK.I..LDLPVLH..FISNN | |
Retrocopy | --HPGNKKEVQTCLK*IQ>LDLPVLHEHFISNN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 2 .92 RPM |
SRP012922_cerebellum | 0 .00 RPM | 8 .25 RPM |
SRP012922_heart | 0 .00 RPM | 3 .94 RPM |
SRP012922_kidney | 0 .00 RPM | 1 .10 RPM |
SRP012922_liver | 0 .00 RPM | 2 .17 RPM |
SRP012922_lung | 0 .00 RPM | 5 .96 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 1 .38 RPM |
SRP012922_spleen | 0 .00 RPM | 7 .33 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000004860 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003177 | 3 retrocopies |
retro_dnov_1334, retro_dnov_1481, retro_dnov_410 ,
|
Homo sapiens | ENSG00000075131 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000000061 | 3 retrocopies | |
Loxodonta africana | ENSLAFG00000026016 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000004386 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000003695 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000012909 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000007192 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000043068 | 1 retrocopy |