RetrogeneDB ID: | retro_dnov_47 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_43468:18874..19144(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSDNOG00000025265 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000016021 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 94.03 % |
| Parental protein coverage: | 74.44 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | SIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIH |
| SI..LKEK.KKRKGRGFGSEEGSRA.MREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIH | |
| Retrocopy | SIQELKEKVKKRKGRGFGSEEGSRAHMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .39 RPM | 27 .03 RPM |
| SRP012922_cerebellum | 0 .41 RPM | 15 .12 RPM |
| SRP012922_heart | 0 .23 RPM | 6 .50 RPM |
| SRP012922_kidney | 0 .55 RPM | 16 .43 RPM |
| SRP012922_liver | 0 .31 RPM | 10 .06 RPM |
| SRP012922_lung | 0 .46 RPM | 18 .17 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 4 .67 RPM |
| SRP012922_spleen | 0 .34 RPM | 17 .28 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000016021 | 1 retrocopy |
retro_dnov_47 ,
|
| Echinops telfairi | ENSETEG00000008411 | 1 retrocopy | |
| Felis catus | ENSFCAG00000026379 | 1 retrocopy | |
| Homo sapiens | ENSG00000131795 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016058 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017436 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000038374 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000000202 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000013316 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000021215 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000013289 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000014947 | 2 retrocopies |