RetrogeneDB ID: | retro_ecab_163 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 1:56846579..56846870(-) | ||
Located in intron of: | ENSECAG00000010181 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL31 | ||
Ensembl ID: | ENSECAG00000024079 | ||
Aliases: | None | ||
Description: | ribosomal protein L31 [Source:HGNC Symbol;Acc:10334] |
Percent Identity: | 62. % |
Parental protein coverage: | 80. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNK |
..P.K.GG...K..SA...V.TREY.INI.K.IHGVGF.KRAP..L.EI.K.AM.EMG.P...IDTRL.K | |
Retrocopy | IVPVKNGG-RTKSCSASHNVETREYSINIQKCIHGVGFRKRAPQVLREIQKSAMQEMGAPNMHIDTRLKK |
Parental | AVWAKGIRNVPYRIRVRLSRKRNEDEDSPN |
..WAKGIRNV.Y...V..SRKRN..EDSPN | |
Retrocopy | TIWAKGIRNVSYCVCVVVSRKRN--EDSPN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 327 .91 RPM |
SRP021940_cerebellum | 0 .00 RPM | 157 .98 RPM |
SRP021940_embryo | 0 .08 RPM | 312 .70 RPM |
SRP021940_placental_villous | 0 .00 RPM | 177 .00 RPM |
SRP021940_synovial_membrane | 0 .03 RPM | 274 .11 RPM |
SRP021940_testis | 0 .00 RPM | 148 .80 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000021031 | 5 retrocopies | |
Equus caballus | ENSECAG00000024079 | 13 retrocopies | |
Latimeria chalumnae | ENSLACG00000013603 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000027873 | 12 retrocopies | |
Macropus eugenii | ENSMEUG00000000963 | 8 retrocopies | |
Myotis lucifugus | ENSMLUG00000002507 | 21 retrocopies |
retro_mluc_1072, retro_mluc_1135, retro_mluc_1239, retro_mluc_1301, retro_mluc_1406, retro_mluc_1470, retro_mluc_1666, retro_mluc_1678, retro_mluc_1896, retro_mluc_1913, retro_mluc_2028, retro_mluc_2124, retro_mluc_2126, retro_mluc_269, retro_mluc_303, retro_mluc_463, retro_mluc_767, retro_mluc_782, retro_mluc_914, retro_mluc_922, retro_mluc_997,
|
Mustela putorius furo | ENSMPUG00000012197 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000014494 | 10 retrocopies | |
Pongo abelii | ENSPPYG00000025870 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000008170 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000025180 | 6 retrocopies |