RetrogeneDB ID: | retro_cpor_341 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_13:29097926..29098281(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL31 | ||
Ensembl ID: | ENSCPOG00000021031 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 58.4 % |
Parental protein coverage: | 96.8 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | KKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWA |
KK.GEK..G.S.I..V.T.EY.INIHK.IHGVGFK.....AL.EI.KFA.KE..T.DV.....LN.A... | |
Retrocopy | KKNGEK--GHSPIHKVLTQEY-INIHKHIHGVGFKEHTSQALREIHKFAIKETATQDVPTRSKLNNA--- |
Parental | KGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTT-FKNLQTV---NVDEN |
..IRNVP..I.V.LSRK..ED..S.NKLYTLVTY..V...FK.LQTV....VDEN | |
Retrocopy | NEIRNVPHCICVWLSRKQKEDAGSSNKLYTLVTYISVSL>FKHLQTV*ERDVDEN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .06 RPM | 98 .47 RPM |
SRP017611_kidney | 0 .31 RPM | 158 .60 RPM |
SRP017611_liver | 0 .13 RPM | 78 .09 RPM |
SRP040447_lung | 0 .18 RPM | 194 .23 RPM |
SRP040447_skeletal_muscle | 0 .03 RPM | 164 .73 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000021031 | 5 retrocopies | |
Equus caballus | ENSECAG00000024079 | 13 retrocopies | |
Latimeria chalumnae | ENSLACG00000013603 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000027873 | 12 retrocopies | |
Macropus eugenii | ENSMEUG00000000963 | 8 retrocopies | |
Myotis lucifugus | ENSMLUG00000002507 | 21 retrocopies |
retro_mluc_1072, retro_mluc_1135, retro_mluc_1239, retro_mluc_1301, retro_mluc_1406, retro_mluc_1470, retro_mluc_1666, retro_mluc_1678, retro_mluc_1896, retro_mluc_1913, retro_mluc_2028, retro_mluc_2124, retro_mluc_2126, retro_mluc_269, retro_mluc_303, retro_mluc_463, retro_mluc_767, retro_mluc_782, retro_mluc_914, retro_mluc_922, retro_mluc_997,
|
Mustela putorius furo | ENSMPUG00000012197 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000014494 | 10 retrocopies | |
Pongo abelii | ENSPPYG00000025870 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000008170 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000025180 | 6 retrocopies |