RetrogeneDB ID: | retro_ecab_289 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 13:31392789..31393201(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL27A | ||
| Ensembl ID: | ENSECAG00000022469 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L27a [Source:HGNC Symbol;Acc:10329] |
| Percent Identity: | 60.14 % |
| Parental protein coverage: | 93.2 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | RLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYHLKRNQSFCPTV |
| RLR...KL.G.VSHG...I.KH.KHPG.RGNAG..HHHR...DK.HPGYFG.V..R.YHL.R.QSFCPTV | |
| Retrocopy | RLREP*KLQGQVSHGDSHISKHQKHPGSRGNAGSRHHHRSILDKCHPGYFGEVSIRRYHLRRSQSFCPTV |
| Parental | NLDKLWTLVSEQTRVNAA-KNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGV |
| N.D.L..L.SE.T.VNA..KN.TG.AP..DVV.......LGK.KL.K.PVI.K..FFS.RA.....GV | |
| Retrocopy | NFDELRALFSEKTWVNAT>KNMTGGAPNMDVV*WS*ENGLGKRKLRKPPVIMKVDFFSGRAKKNKDGV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 642 .89 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 315 .59 RPM |
| SRP021940_embryo | 0 .00 RPM | 458 .93 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 308 .92 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 405 .08 RPM |
| SRP021940_testis | 0 .00 RPM | 235 .38 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004205 | 15 retrocopies | |
| Bos taurus | ENSBTAG00000005349 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000006936 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000011775 | 1 retrocopy | |
| Equus caballus | ENSECAG00000022469 | 1 retrocopy |
retro_ecab_289 ,
|
| Felis catus | ENSFCAG00000008411 | 13 retrocopies | |
| Loxodonta africana | ENSLAFG00000000425 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016616 | 7 retrocopies | |
| Mus musculus | ENSMUSG00000046364 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005442 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014214 | 10 retrocopies | |
| Sus scrofa | ENSSSCG00000014569 | 9 retrocopies |