RetrogeneDB ID: | retro_ecab_618 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 23:28823260..28823683(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C1orf43 | ||
Ensembl ID: | ENSECAG00000017585 | ||
Aliases: | None | ||
Description: | chromosome 1 open reading frame 43 [Source:HGNC Symbol;Acc:29876] |
Percent Identity: | 54.11 % |
Parental protein coverage: | 56.52 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | GHNAPKDLKEEIDIRLSRVQDIKYEPQLL-ADDDARLLQLETQGNQNCYNYLYRMKALDAIRASEIPFHA |
G...PK.LKEEID..LSR.QD.K..P.LL.AD.D..LLQ.ETQGNQ.C.NYLY..K.L....A.EIP.HA | |
Retrocopy | GRQCPKFLKEEIDTQLSRKQDVKH*PELL<AD*DGSLLQRETQGNQYCKNYLYSTKTLASKSAFEIPLHA |
Parental | DGRHPCSLMGKNFRSYLLDLRNSST-PFKGVRKALIDTLLDGYETARYG-TGVFGQSEYLRYQEALSELA |
.......LM...F.SY.LDL.N....PFK...KAL.D.LLDGYE.A..G..GV..QSE.L..QEA..EL. | |
Retrocopy | VDQQLHFLMSEHFSSY-LDL*NTCI<PFKRACKALLDILLDGYESACSG<EGVCVQSEHLFFQEAECELT |
Parental | TVVKAR |
....A. | |
Retrocopy | ETIEAQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 19 .48 RPM |
SRP021940_cerebellum | 0 .00 RPM | 37 .34 RPM |
SRP021940_embryo | 0 .00 RPM | 26 .14 RPM |
SRP021940_placental_villous | 0 .00 RPM | 30 .60 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 20 .64 RPM |
SRP021940_testis | 0 .00 RPM | 77 .56 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011865 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009722 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000019160 | 1 retrocopy | |
Equus caballus | ENSECAG00000017585 | 2 retrocopies |
retro_ecab_618 , retro_ecab_814,
|
Echinops telfairi | ENSETEG00000001056 | 15 retrocopies | |
Macropus eugenii | ENSMEUG00000002600 | 6 retrocopies | |
Myotis lucifugus | ENSMLUG00000013338 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017237 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000012008 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000002717 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017758 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000012915 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000015824 | 1 retrocopy |