RetrogeneDB ID: | retro_shar_740 | ||
Retrocopylocation | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
Coordinates: | GL861672.1:121721..122161(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C1orf43 | ||
Ensembl ID: | ENSSHAG00000012915 | ||
Aliases: | None | ||
Description: | chromosome 1 open reading frame 43 [Source:HGNC Symbol;Acc:29876] |
Percent Identity: | 54.67 % |
Parental protein coverage: | 63.36 % |
Number of stop codons detected: | 5 |
Number of frameshifts detected | 3 |
Parental | FVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSKVQDVKYEPQLLEEDDARLLQLETPG |
FVLL.IF.K.QIM.FA.KS.R.PH.PV.HNA.KD.KEEI.I..SK..DV.YEP.LL....A..L.LET.. | |
Retrocopy | FVLLSIFNKGQIMPFAIKSQRMPHIPVRHNATKDQKEEISIL*SKI*DVEYEP*LLRKNGASTLHLETQE |
Parental | NQ-HCYNYLYRMKALDAIRASEIPFHSE-GRHPRSLMGKNFRSYLLELRNTSTPFKGV-RKALIDTLLDG |
N...CYNYLYRMK.L....A..I.F..E......SLMG..F.S.LL.L.NT..P.K....KAL.D.LL.. | |
Retrocopy | NN>YCYNYLYRMKVLGTPYACKILFQEE<NKYLPSLMG*HFHSCLLDL*NTNVPIKDL<HKALTDILLVW |
Parental | YETARYGTGV |
Y..A.YGT.. | |
Retrocopy | YKKAQYGTNI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011865 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009722 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000019160 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000005454 | 1 retrocopy | |
Equus caballus | ENSECAG00000017585 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000001056 | 15 retrocopies | |
Macropus eugenii | ENSMEUG00000002600 | 6 retrocopies | |
Myotis lucifugus | ENSMLUG00000013338 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017237 | 3 retrocopies | |
Mus musculus | ENSMUSG00000027942 | 6 retrocopies | |
Otolemur garnettii | ENSOGAG00000012008 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000007244 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000000785 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000002717 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017758 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000012915 | 1 retrocopy |
retro_shar_740 ,
|
Tupaia belangeri | ENSTBEG00000013866 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012777 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000015824 | 1 retrocopy |