RetrogeneDB ID: | retro_eeur_339 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_263615:3729..3956(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPE | ||
Ensembl ID: | ENSEEUG00000006187 | ||
Aliases: | None | ||
Description: | small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:11161] |
Percent Identity: | 67.53 % |
Parental protein coverage: | 82.22 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | PINLIFRYLQNRS-RIQVWLYEQVNMRIEGCIIXXXXXXXXXXXDA-EIHSKTKSRKQLG-IMLKGDNIT |
P..LIFRYLQNRS..IQV.LY.Q.NM..EGCII...........DA.EIHSKTKSRKQ.G.IMLK.DNIT | |
Retrocopy | PTSLIFRYLQNRS<MIQV*LYVQENMQTEGCIIGFDEYVILVLDDAQEIHSKTKSRKQQGQIMLKRDNIT |
Parental | LLQSVSN |
.LQSVSN | |
Retrocopy | QLQSVSN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 1 .13 RPM |
SRP017611_kidney | 0 .00 RPM | 1 .88 RPM |
SRP017611_liver | 0 .00 RPM | 1 .13 RPM |