RetrogeneDB ID: | retro_etel_606 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_102334:293..531(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSETEG00000000263 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 62.5 % |
| Parental protein coverage: | 63.2 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | IPKVEWSALLEAAETLHLTEVPSAPAEGYERDEEFLRKMHHVLLEVDVLEGTLQC-PESGRLFPISRGIP |
| IPKVEW.ALLEA..TLHL..VP..P.EG.E..E.FL.K..H.LLE...LEGT....P..GRLFP.S.GIP | |
| Retrocopy | IPKVEWVALLEATDTLHLAKVPRGPMEG*EWHEDFLKKIPHMLLEMGGLEGTPHW>PQFGRLFPNSLGIP |
| Parental | NKDRNDEETE |
| N...NDEETE | |
| Retrocopy | NMLLNDEETE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017965 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000008646 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018026 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004644 | 1 retrocopy | |
| Equus caballus | ENSECAG00000016960 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000263 | 4 retrocopies | |
| Homo sapiens | ENSG00000173113 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001334 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000019647 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000004130 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000019857 | 1 retrocopy |