RetrogeneDB ID: | retro_ggor_1165 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 15:70097018..70097435(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PERP | ||
| Ensembl ID: | ENSGGOG00000028340 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.52 % |
| Parental protein coverage: | 71.5 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | GGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFF-ALCGPQMLVFLRVIGGLLALAAVFQII |
| GGSGS.EEGC.SLMEYAWGRAAAAMLF.G..ILVICFILSFF..LC.PQ..VFLRVIGGLLALAAVFQII | |
| Retrocopy | GGSGS*EEGCHSLMEYAWGRAAAAMLFWGVSILVICFILSFFFVLCVPQIHVFLRVIGGLLALAAVFQII |
| Parental | SLVIYPVKYTQ-TFALHA-NPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTS |
| SLVIYPVKYTQ.TF.LHA..PAVT.IYNWAYGFGWAA.IILIGCAFF.CCLP.YEDDLLGN.KPRYFYTS | |
| Retrocopy | SLVIYPVKYTQ<TFNLHA>SPAVTSIYNWAYGFGWAAMIILIGCAFFCCCLPSYEDDLLGNTKPRYFYTS |
| Parental | A |
| A | |
| Retrocopy | A |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 7 .15 RPM | 1 .49 RPM |
| SRP007412_cerebellum | 4 .69 RPM | 3 .35 RPM |
| SRP007412_heart | 0 .81 RPM | 13 .76 RPM |
| SRP007412_kidney | 1 .55 RPM | 18 .11 RPM |
| SRP007412_liver | 0 .95 RPM | 52 .07 RPM |
| SRP007412_testis | 1 .76 RPM | 4 .04 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1523 |
| Pongo abelii | retro_pabe_1267 |
| Macaca mulatta | retro_mmul_2156 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000020097 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019024 | 1 retrocopy | |
| Homo sapiens | ENSG00000112378 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028340 | 1 retrocopy |
retro_ggor_1165 ,
|
| Macropus eugenii | ENSMEUG00000004872 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013979 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000001473 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000997 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014930 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000004238 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011669 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017043 | 3 retrocopies |