RetrogeneDB ID: | retro_ggor_1678 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2a:43327030..43327254(-) | ||
Located in intron of: | ENSGGOG00000006895 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MYCBP | ||
Ensembl ID: | ENSGGOG00000005810 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 60.53 % |
Parental protein coverage: | 72.82 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | HYKAADSKREQFRRYLEKSGVLDTLTKVLVALYE-EPEKPNSALDFLKHHLGAATPENPEIELLRLELAE |
HY........Q....LE....L...TKVLVAL...EPEKPN.AL.FLKH.LG.A.PENPEIELL.LEL.E | |
Retrocopy | HYGPLEYC*LQDQAILEVLRALGC*TKVLVALEK<EPEKPNTALVFLKHDLGVAIPENPEIELLPLELTE |
Parental | MKEKYE |
MK.KYE | |
Retrocopy | MKDKYE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .93 RPM |
SRP007412_cerebellum | 0 .00 RPM | 4 .57 RPM |
SRP007412_heart | 0 .00 RPM | 1 .84 RPM |
SRP007412_kidney | 0 .00 RPM | 15 .62 RPM |
SRP007412_liver | 0 .03 RPM | 8 .47 RPM |
SRP007412_testis | 0 .00 RPM | 34 .91 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_1594 |