RetrogeneDB ID: | retro_ocun_907 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 17:21524588..21524831(+) | ||
Located in intron of: | ENSOCUG00000007193 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MYCBP | ||
Ensembl ID: | ENSOCUG00000022203 | ||
Aliases: | None | ||
Description: | MYC binding protein [Source:HGNC Symbol;Acc:7554] |
Percent Identity: | 81.48 % |
Parental protein coverage: | 64.29 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKTKLAQ |
VLDTLTKVL.AL..EPEKP.SALDFLKHHLGAATPEN.EIELLRL.LAE..EKYEA...EN.KLK.KLAQ | |
Retrocopy | VLDTLTKVLAALHKEPEKPDSALDFLKHHLGAATPENAEIELLRLQLAEVEEKYEATKGEN*KLKIKLAQ |
Parental | YEPPQEEKRAE |
.EPPQEEK.AE | |
Retrocopy | QEPPQEEKHAE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 2 .26 RPM |
SRP017611_kidney | 0 .00 RPM | 9 .22 RPM |
SRP017611_liver | 0 .00 RPM | 3 .31 RPM |