RetrogeneDB ID: | retro_meug_247 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | GeneScaffold_7653:53210..53531(+) | ||
Located in intron of: | ENSMEUG00000007806 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MYCBP | ||
Ensembl ID: | ENSMEUG00000000315 | ||
Aliases: | None | ||
Description: | MYC binding protein [Source:HGNC Symbol;Acc:7554] |
Percent Identity: | 77.06 % |
Parental protein coverage: | 97.27 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | AAVTMAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLR |
AAVTMAHY.A..SKREQ..RYLEK.GV.D.LTK...ALY.EPEK.NS.LDFLKH..GAATPENPEI.LL. | |
Retrocopy | AAVTMAHYTATSSKREQLWRYLEKLGVVDMLTKASAALYKEPEKLNSVLDFLKHYFGAATPENPEIQLLH |
Parental | LELAEVKEKY-EAVVEEN-KKLKTKLAQYEPLQEEKRAE |
.ELAEVKEK..EAVVEEN.KK.KTKLAQ.EPLQEEK.AE | |
Retrocopy | RELAEVKEKQ<EAVVEEN>KKVKTKLAQHEPLQEEKCAE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000030622 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000013136 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000036558 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000020447 | 1 retrocopy | |
Homo sapiens | ENSG00000214114 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000005810 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000020514 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000000315 | 1 retrocopy |
retro_meug_247 ,
|
Mus musculus | ENSMUSG00000028647 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011814 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000022203 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000024435 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000001515 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000000565 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000017166 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000003649 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000021547 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000005690 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009583 | 1 retrocopy |