RetrogeneDB ID: | retro_mmus_1626 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 17:21968489..21968775(-) | ||
Located in intron of: | ENSMUSG00000053347 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Mycbp | ||
Ensembl ID: | ENSMUSG00000028647 | ||
Aliases: | Mycbp, 5730488M09Rik, AW552132, AW742590, Amy-1 | ||
Description: | c-myc binding protein [Source:MGI Symbol;Acc:MGI:1891750] |
Percent Identity: | 65.31 % |
Parental protein coverage: | 94.17 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | ADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPTSALDFLKHHLGAATPENPEIELLRLELAEMKEKY |
.D.K.....RY...S.VLDT...VLVAL.EEP....SAL.FLK.HLGAAT..NPEIELL.LELAEM.EK. | |
Retrocopy | SDWKHK*L*RY*WRSRVLDTVA*VLVALNEEPQNRASALEFLKYHLGAATMKNPEIELLCLELAEMIEK- |
Parental | EATVEENK-KLKAKLVQYEPPQEEKRAE |
.ATV...K.KLKAKL.Q.EPPQEEK.AE | |
Retrocopy | -ATVDKKK>KLKAKLAQSEPPQEEKHAE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 4 .60 RPM |
SRP007412_cerebellum | 0 .00 RPM | 7 .73 RPM |
SRP007412_heart | 0 .00 RPM | 7 .50 RPM |
SRP007412_kidney | 0 .02 RPM | 13 .94 RPM |
SRP007412_liver | 0 .00 RPM | 10 .30 RPM |
SRP007412_testis | 0 .00 RPM | 19 .71 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000030622 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000013136 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000036558 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000020447 | 1 retrocopy | |
Homo sapiens | ENSG00000214114 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000005810 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000020514 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000000315 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028647 | 1 retrocopy |
retro_mmus_1626 ,
|
Nomascus leucogenys | ENSNLEG00000011814 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000022203 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000024435 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000001515 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000000565 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000017166 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000003649 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000021547 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000005690 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009583 | 1 retrocopy |