RetrogeneDB ID: | retro_itri_1710 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393650.1:351763..351982(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DNAJC15 | ||
Ensembl ID: | ENSSTOG00000012805 | ||
Aliases: | None | ||
Description: | DnaJ (Hsp40) homolog, subfamily C, member 15 [Source:HGNC Symbol;Acc:20325] |
Percent Identity: | 57.33 % |
Parental protein coverage: | 66.37 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | SSSSLSSYYKGGFEQKMSRREASLILGVSPSAGKAKIRMAHKRIMILNHPDKGGSPYLATKINEAKDLLE |
.S...SS..KGG.E.KM.R.E.S.ILGV..S.GK.KI.MAH.RIMILN.PDK.G...L.....EAKDL.E | |
Retrocopy | TSRKISSFSKGGCEEKMRR*ETSVILGVNTSPGKGKIGMAHRRIMILN*PDKAGC--L*INNSEAKDLPE |
Parental | ATTKY |
A..K. | |
Retrocopy | AISKH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |