RetrogeneDB ID: | retro_eeur_95 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | GeneScaffold_5882:8794..9011(-) | ||
Located in intron of: | ENSEEUG00000013459 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DNAJC15 | ||
Ensembl ID: | ENSEEUG00000008785 | ||
Aliases: | None | ||
Description: | DnaJ (Hsp40) homolog, subfamily C, member 15 [Source:HGNC Symbol;Acc:20325] |
Percent Identity: | 85.14 % |
Parental protein coverage: | 50.69 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | AFAGRYAFQIWKPLEQVITETAKKISTPSLLSYYKGGFEQKMSRREASLILGVSP-SAGKAKIRTAHRRI |
AFAGRYAFQIWKPLE.VITETAKKISTPSLLSY.KGGFEQ.MS..EASL..GV.P.SAG.AKIRTAHRRI | |
Retrocopy | AFAGRYAFQIWKPLEHVITETAKKISTPSLLSYRKGGFEQEMSSQEASL-TGV*P>SAGQAKIRTAHRRI |
Parental | MILN |
MIL. | |
Retrocopy | MILS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 16 .76 RPM |
SRP017611_kidney | 0 .19 RPM | 39 .95 RPM |
SRP017611_liver | 0 .16 RPM | 26 .53 RPM |