RetrogeneDB ID: | retro_itri_552 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393301.1:612284..612506(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DNAJC19 | ||
Ensembl ID: | ENSSTOG00000011508 | ||
Aliases: | None | ||
Description: | DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528] |
Percent Identity: | 65.79 % |
Parental protein coverage: | 58.91 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | VLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFETKMTKREAALILGVSPTANKAKIRDAHRRIMLLNHP |
.LQAMKHMEPQVK..FQSLPKSA.SG..YRGGFE.KMTK.EA.LIL...P.....KIRDA...IMLLN.P | |
Retrocopy | ILQAMKHMEPQVKYKFQSLPKSAVSGSCYRGGFEIKMTKQEATLIL-FKPYSQ*RKIRDA-*QIMLLNCP |
Parental | DKGPLV |
....L. | |
Retrocopy | KEDLLL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |