RetrogeneDB ID: | retro_itri_644 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393308.1:3677168..3677391(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL36A | ||
Ensembl ID: | ENSSTOG00000027251 | ||
Aliases: | None | ||
Description: | ribosomal protein L36a [Source:HGNC Symbol;Acc:10359] |
Percent Identity: | 51.95 % |
Parental protein coverage: | 52.82 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | YILPFPALFLSFLADNAAANMVNVPKTRRTFCK-KCGKH-QPHKVTQYKKGKDSLYAQGKRRYDRKQSGY |
..L.F......F....A...M.NVPK...TF...KCGK..Q.HKVTQYK..KDSL..Q....YDRKQSG. | |
Retrocopy | FYLLFILFLIHFSSCIASTYMMNVPKIH*TFHE<KCGKP<QTHKVTQYKEVKDSLCVQRDWSYDRKQSG* |
Parental | GGQTKPI |
GGQT..I | |
Retrocopy | GGQTNLI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |