RetrogeneDB ID: | retro_mmul_1276 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 17:3608941..3609315(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGA1 | ||
Ensembl ID: | ENSMMUG00000019529 | ||
Aliases: | None | ||
Description: | high mobility group protein HMG-I/HMG-Y [Source:RefSeq peptide;Acc:NP_001253281] |
Percent Identity: | 68.22 % |
Parental protein coverage: | 71.11 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | KEPSEVPTPKRPRGRPKGSKNKAWPRRKRRASRRNPRRRSSDPCVPPAPHWRSSFLLGLDSFAPLPPPPP |
K.......P........G.....W..RKRRAS.R.P.RRSSDPCVPPAP.WRSSFLL.LDSFA..PPP.P | |
Retrocopy | KDAAKT*KPPQLQEGNQGADPQNWRGRKRRASCRSP-RRSSDPCVPPAPAWRSSFLLTLDSFA--PPPLP |
Parental | LPQTHHHHRLWPPPPSSTCALT-TTLHSTPAAAGLPWAEWGAVFPWPQFPAPPAHPRIH |
.PQ.HHHHRLWPPPPSSTCAL..TTLHSTPAAAG.PWAEWGAVF...QFPA.PAHP..H | |
Retrocopy | PPQAHHHHRLWPPPPSSTCALS<TTLHSTPAAAGRPWAEWGAVFTRLQFPASPAHPHTH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 12 .33 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 40 .14 RPM |
SRP007412_cerebellum | 0 .00 RPM | 11 .69 RPM |
SRP007412_heart | 0 .00 RPM | 7 .30 RPM |
SRP007412_kidney | 0 .00 RPM | 3 .40 RPM |
SRP007412_liver | 0 .00 RPM | 4 .28 RPM |
SRP007412_testis | 0 .00 RPM | 40 .52 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001061 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000015226 | 2 retrocopies | |
Homo sapiens | ENSG00000137309 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000010085 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000019529 | 2 retrocopies |
retro_mmul_1276 , retro_mmul_2406,
|
Mus musculus | ENSMUSG00000046711 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000008303 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000016076 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000029838 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000040884 | 6 retrocopies | |
Pteropus vampyrus | ENSPVAG00000014283 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000488 | 1 retrocopy |