RetrogeneDB ID: | retro_mmul_1479 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 2:168166398..168166628(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CRIP1 | ||
| Ensembl ID: | ENSMMUG00000007158 | ||
| Aliases: | None | ||
| Description: | cysteine-rich protein 1 [Source:RefSeq peptide;Acc:NP_001253775] |
| Percent Identity: | 82.05 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCG-KTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRG |
| .PKC.K..KEVYFAERVTSLGKDWHRPCLKC.K.G.KTLTSGG.AE.EG.P.CNHPCYAAMF..KGFGRG | |
| Retrocopy | IPKCLKYDKEVYFAERVTSLGKDWHRPCLKCQKVG<KTLTSGGRAEQEGRPCCNHPCYAAMFEQKGFGRG |
| Parental | GAESHTFK |
| GA.SHTFK | |
| Retrocopy | GADSHTFK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 1 .79 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .01 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .97 RPM |
| SRP007412_heart | 0 .00 RPM | 26 .20 RPM |
| SRP007412_kidney | 0 .00 RPM | 10 .21 RPM |
| SRP007412_liver | 0 .00 RPM | 8 .75 RPM |
| SRP007412_testis | 0 .04 RPM | 1 .02 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000047229 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019788 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001365 | 1 retrocopy | |
| Homo sapiens | ENSG00000213145 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027381 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001631 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007158 | 2 retrocopies |
retro_mmul_1479 , retro_mmul_553,
|
| Macaca mulatta | ENSMMUG00000018257 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020772 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006209 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000033768 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000014240 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000027990 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000000807 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004063 | 1 retrocopy |