RetrogeneDB ID: | retro_pabe_114 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 22:19683534..19683762(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSPPYG00000011652 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000006209 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 88.89 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ERVTSLGKDWHRPCVKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK |
ERVTSLGKDWHRPC.KCEKCGKTLTSGGHAEH..KPYC..PCYAAMFGPKGFGRGG.E.HTFK | |
Retrocopy | ERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHDSKPYCYYPCYAAMFGPKGFGRGGSERHTFK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .33 RPM | 1 .82 RPM |
SRP007412_cerebellum | 0 .12 RPM | 0 .85 RPM |
SRP007412_heart | 1 .35 RPM | 6 .98 RPM |
SRP007412_kidney | 1 .43 RPM | 6 .53 RPM |
SRP007412_liver | 0 .67 RPM | 4 .10 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000047229 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000019788 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000001365 | 1 retrocopy | |
Homo sapiens | ENSG00000213145 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027381 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000001631 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007158 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000004790 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000006209 | 1 retrocopy |
retro_pabe_114 ,
|
Pan troglodytes | ENSPTRG00000033768 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000014240 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000027990 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000000807 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000004063 | 1 retrocopy |