RetrogeneDB ID: | retro_shar_341 | ||
Retrocopylocation | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
Coordinates: | GL841396.1:3781362..3781534(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSSHAG00000000807 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 75.86 % |
Parental protein coverage: | 74.03 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MPKCPKCEKEVYFAERVTSLGKDWHRPCLKCEKCGKTL-TSGGHAEHEGKPYCNHPCY |
MPKCPK.EKEVYFAE.VTSLGK.WH..CLKCEKCGKTL...GGH....GK.YCN.PCY | |
Retrocopy | MPKCPKREKEVYFAEHVTSLGKEWHQSCLKCEKCGKTL>DTGGHTKQKGKSYCNYPCY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000047229 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000019788 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000001365 | 1 retrocopy | |
Homo sapiens | ENSG00000213145 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027381 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000001631 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007158 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000006209 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000033768 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000014240 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000027990 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000000807 | 1 retrocopy |
retro_shar_341 ,
|
Tursiops truncatus | ENSTTRG00000004063 | 1 retrocopy |