RetrogeneDB ID: | retro_mmul_553 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 1:168400406..168400633(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CRIP1 | ||
Ensembl ID: | ENSMMUG00000007158 | ||
Aliases: | None | ||
Description: | cysteine-rich protein 1 [Source:RefSeq peptide;Acc:NP_001253775] |
Percent Identity: | 70.13 % |
Parental protein coverage: | 97.4 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSG-GHAEHEGKPYCNHPCYAAMFGPKGFGRG |
.PKC.KCNKE..FA..VTSLGKDWHRPCLKCEKC...L....GH.EHEGKPY.NH.CY.AMFG.KGF..G | |
Retrocopy | IPKCTKCNKERSFAKWVTSLGKDWHRPCLKCEKCV*MLGAKLGHVEHEGKPY*NHLCYYAMFGLKGFV*G |
Parental | G-AESHT |
...ESHT | |
Retrocopy | R<TESHT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 1 .79 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .01 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .97 RPM |
SRP007412_heart | 0 .00 RPM | 26 .20 RPM |
SRP007412_kidney | 0 .00 RPM | 10 .21 RPM |
SRP007412_liver | 0 .00 RPM | 8 .75 RPM |
SRP007412_testis | 0 .00 RPM | 1 .02 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000047229 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000019788 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000001365 | 1 retrocopy | |
Homo sapiens | ENSG00000213145 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027381 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000001631 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007158 | 2 retrocopies |
retro_mmul_1479, retro_mmul_553 ,
|
Macaca mulatta | ENSMMUG00000018257 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020772 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006209 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000033768 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000014240 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000027990 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000000807 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000004063 | 1 retrocopy |