RetrogeneDB ID: | retro_mmul_1571 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 20:75295606..75295976(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TPRKB | ||
Ensembl ID: | ENSMMUG00000030805 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 56.69 % |
Parental protein coverage: | 71.43 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVA-ANKAVHLYKLGK |
M.LTHQLD.FP.C.V..LLF.D.K.A.DLR.K..E....GSLIN..V..D.FQILVA..NKAVHLYK.GK | |
Retrocopy | MPLTHQLDVFPKCGVIILLFEDIKSAEDLR*KVTEVIFNGSLINAMVTIDLFQILVA<INKAVHLYKVGK |
Parental | MKTRTLSTEIIFNLSPNNNISEALKKF-GISANDTSILIVYIEEGEKQINQEYLISQ |
.KTR.L..EII.N.SPNN.I.EALKK....S.N.T.ILI......E......Y..S. | |
Retrocopy | IKTRILCMEIIPNVSPNNIILEALKKI<YVSINGTLILI-FLQ*KERRNQELYMLSR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 5 .27 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .62 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .52 RPM |
SRP007412_heart | 0 .00 RPM | 4 .12 RPM |
SRP007412_kidney | 0 .00 RPM | 4 .23 RPM |
SRP007412_liver | 0 .00 RPM | 1 .39 RPM |
SRP007412_testis | 0 .00 RPM | 9 .16 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000012021 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004162 | 3 retrocopies | |
Homo sapiens | ENSG00000144034 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009062 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000030805 | 1 retrocopy |
retro_mmul_1571 ,
|
Monodelphis domestica | ENSMODG00000016950 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000300 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016251 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000032893 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000012292 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000012419 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000016406 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000014584 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000007934 | 2 retrocopies |