RetrogeneDB ID: | retro_mmul_1572 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 20:87575627..87575977(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.4156 | ||
| Ensembl ID: | ENSMMUG00000017375 | ||
| Aliases: | None | ||
| Description: | UMP-CMP kinase [Source:RefSeq peptide;Acc:NP_001180547] |
| Percent Identity: | 68.85 % |
| Parental protein coverage: | 51.75 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 4 |
| Parental | EMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMD-GKADVSFVLFFDCNNEICIERCLER-GKSSGRSD |
| EMDQTMAANA..NKFLID.F.RNQDNLQGW.K.MD..KADV..VLF.D.N.EICI..CLER.G.S.G.S. | |
| Retrocopy | EMDQTMAANAT-NKFLIDEFLRNQDNLQGWAKSMD>RKADVHLVLFSDHNIEICIKACLER>GNS-GKSE |
| Parental | DNRESLEKRIQTYLQ-STKPIIDLYEEMGKVKKIDASKSVDEV-FDEVVQIF |
| D.RESL.KRIQ..LQ..TK.I.D.YEE.GKV.K.DASK.V.EV.F.EVV..F | |
| Retrocopy | DSRESLGKRIQIHLQ>LTKTITDSYEEIGKVNKTDASKPVHEV<FSEVVKNF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 19 .72 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 15 .31 RPM |
| SRP007412_cerebellum | 0 .26 RPM | 23 .38 RPM |
| SRP007412_heart | 0 .06 RPM | 14 .90 RPM |
| SRP007412_kidney | 0 .23 RPM | 21 .71 RPM |
| SRP007412_liver | 0 .04 RPM | 14 .92 RPM |
| SRP007412_testis | 0 .04 RPM | 4 .22 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000012 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000004030 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004014 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000021250 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000014747 | 4 retrocopies | |
| Felis catus | ENSFCAG00000025426 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017375 | 2 retrocopies |
retro_mmul_1572 , retro_mmul_66,
|
| Mustela putorius furo | ENSMPUG00000012394 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028719 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000026904 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001380 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000007775 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000009745 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000003885 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000017494 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000007511 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000004127 | 2 retrocopies |