RetrogeneDB ID: | retro_mmul_1643 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 3:162885571..162885974(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MTX2 | ||
Ensembl ID: | ENSMMUG00000010185 | ||
Aliases: | MTX2, metaxin-2 | ||
Description: | metaxin-2 [Source:RefSeq peptide;Acc:NP_001248051] |
Percent Identity: | 73.19 % |
Parental protein coverage: | 51.71 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | LYLQWCDEAT-VGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQ |
LYLQW.DE....GEITHARYGSPYP.PL.HILAYQKQ..VK.K.KAI.WGKKTL.QVLED.DQCCQALSQ | |
Retrocopy | LYLQWLDEPK<IGEITHARYGSPYPSPLHHILAYQKQ*KVKCKVKAIRWGKKTLEQVLEDIDQCCQALSQ |
Parental | RLGTQP-YFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQHYFEDRGKGRL |
.LGT.P..F.NKQ..E.D.LVFGHLYTILTTQL.ND.LSE.VKN.S.LLA.C.R.E.HYF....KGR. | |
Retrocopy | SLGT*P<MFLNKQLCEFDTLVFGHLYTILTTQLMNDKLSE-VKNCSKLLALCKRNERHYFDYCEKGRM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 19 .94 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .18 RPM |
SRP007412_cerebellum | 0 .00 RPM | 15 .11 RPM |
SRP007412_heart | 0 .00 RPM | 13 .07 RPM |
SRP007412_kidney | 0 .00 RPM | 19 .60 RPM |
SRP007412_liver | 0 .00 RPM | 5 .19 RPM |
SRP007412_testis | 0 .11 RPM | 53 .00 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3780 |
Pan troglodytes | retro_ptro_2561 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000009655 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000011099 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000003848 | 2 retrocopies | |
Homo sapiens | ENSG00000128654 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010185 | 1 retrocopy |
retro_mmul_1643 ,
|
Macaca mulatta | ENSMMUG00000021104 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006020 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000012674 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000016381 | 1 retrocopy |