RetrogeneDB ID: | retro_mmul_1778 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 4:85695122..85695551(+) | ||
Located in intron of: | ENSMMUG00000029536 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM64A | ||
Ensembl ID: | ENSMMUG00000017760 | ||
Aliases: | None | ||
Description: | family with sequence similarity 64, member A [Source:HGNC Symbol;Acc:25483] |
Percent Identity: | 55.41 % |
Parental protein coverage: | 60.5 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 4 |
Parental | AMSQRIQESCQSGTKWLVETHVKARRRKRGAQTGSG-SPAHSLSQKSTRLSGAAPAHSATEPWEKE-RHH |
AMSQRI..SCQS.TKWLVET.VKA.RR........G...A..L.....R..G.......T.P......HH | |
Retrocopy | AMSQRIHKSCQSSTKWLVETQVKA-RRRKKRFKKGG<AVAPQLAA*ARRVFGCPELPLTTQPQTPR>HHH |
Parental | LSARMGSRAHPSRRSRREAAFRSPYSSTEPLCSPRQSDSDPEPV-GAGIQHLQKLSQELEEAIMAXXSGD |
LS...GSRAHP.R....EAAF.SP.SSTE.LCSP...DSD.E...GAGI.HLQKLSQEL.EAIMA..SG. | |
Retrocopy | LSTWTGSRAHPLRQWKQEAAFQSPCSSTELLCSPSEYDSDLEAM>GAGIRHLQKLSQELDEAIMAEESGE |
Parental | II-SLIHD |
....LIHD | |
Retrocopy | MT<TLIHD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .22 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .06 RPM | 0 .06 RPM |
SRP007412_heart | 0 .06 RPM | 0 .06 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .11 RPM | 0 .11 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006997 | 1 retrocopy | |
Homo sapiens | ENSG00000129195 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000012309 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000017760 | 3 retrocopies |
retro_mmul_1778 , retro_mmul_1935, retro_mmul_959,
|
Mus musculus | ENSMUSG00000020808 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000009164 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000027433 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000007877 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000008641 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000008040 | 1 retrocopy |