RetrogeneDB ID: | retro_mmul_1914 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 5:142022837..142023172(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AKIRIN2 | ||
Ensembl ID: | ENSMMUG00000002824 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 86.09 % |
Parental protein coverage: | 56.16 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | KRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKER |
K..QKRR..E.SFQQ.DPCCTSDA..HAFLL.G.ASPGTSSAASSPLKKEQPLFTL.QVGMICE.LLKER | |
Retrocopy | KERQKRRYSEMSFQQIDPCCTSDA--HAFLLTGSASPGTSSAASSPLKKEQPLFTLWQVGMICEHLLKER |
Parental | EEKVREEYEE-ILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS |
EEKV.EEYEE.ILNTKLAEQY.A.VKFTHDQIMRRYGEQPASYVS | |
Retrocopy | EEKVWEEYEE<ILNTKLAEQYVASVKFTHDQIMRRYGEQPASYVS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 31 .15 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 39 .19 RPM |
SRP007412_cerebellum | 0 .00 RPM | 27 .70 RPM |
SRP007412_heart | 0 .00 RPM | 19 .90 RPM |
SRP007412_kidney | 0 .00 RPM | 20 .19 RPM |
SRP007412_liver | 0 .00 RPM | 13 .30 RPM |
SRP007412_testis | 0 .00 RPM | 25 .41 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2991 |
Pan troglodytes | retro_ptro_2023 |
Gorilla gorilla | retro_ggor_2071 |
Pongo abelii | retro_pabe_2477 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000003082 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000012160 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000000769 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000000549 | 1 retrocopy | |
Homo sapiens | ENSG00000135334 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002448 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000002824 | 1 retrocopy |
retro_mmul_1914 ,
|
Pongo abelii | ENSPPYG00000016831 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000018409 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000008288 | 1 retrocopy | |
Sorex araneus | ENSSARG00000006084 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000011555 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000004307 | 1 retrocopy |