RetrogeneDB ID: | retro_rnor_1499 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 2:73625842..73626170(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Akirin2 | ||
Ensembl ID: | ENSRNOG00000008288 | ||
Aliases: | Akirin2, FBI1, RGD1307791 | ||
Description: | Akirin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q25C79] |
Percent Identity: | 51.82 % |
Parental protein coverage: | 54.23 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | RRHLEASFQQTDPGCSSDSQPHAFLISGPASPGTSSATSSPLKKEQPLFTLRQVGMICERLL-KEREEKV |
R.HLE......DPGC.S...P..FL..GP..P.T..A.SSP...EQPLFTL.Q...IC.....KE.EE.V | |
Retrocopy | RKHLETPSHLKDPGCGSQA*PQVFLLHGPVTPVT*WAASSPSIEEQPLFTLWQNRIICKCFV>KESEEEV |
Parental | REEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS |
....EEI...K.A.QYDA.VK..HDQIM..YGE.PA...S | |
Retrocopy | *GKCEEIVHIK*AGQYDALVKIIHDQIMSQYGEEPANCAS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 47 .74 RPM |
SRP017611_kidney | 0 .00 RPM | 35 .73 RPM |
SRP017611_liver | 0 .00 RPM | 14 .32 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000003082 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000012160 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000000769 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000000549 | 1 retrocopy | |
Homo sapiens | ENSG00000135334 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002448 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000002824 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016831 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000018409 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000008288 | 1 retrocopy |
retro_rnor_1499 ,
|
Sorex araneus | ENSSARG00000006084 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000011555 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000004307 | 1 retrocopy |