RetrogeneDB ID: | retro_mmus_3482 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:84880001..84880207(+) | ||
| Located in intron of: | ENSMUSG00000045103 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000084281 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rps15a | ||
| Ensembl ID: | ENSMUSG00000008683 | ||
| Aliases: | Rps15a, A630031B11Rik | ||
| Description: | ribosomal protein S15A [Source:MGI Symbol;Acc:MGI:2389091] |
| Percent Identity: | 65.71 % |
| Parental protein coverage: | 53.08 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | IGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLL-PSRQFGFIVLTTSAGIMDHEE |
| I.EF..I.DHRAGKI.VNL.GRLN.CG..S.RF.VQLKDLEK..NNLL..S.Q.GF.VLTTS..I.D... | |
| Retrocopy | IDEFKFISDHRAGKIRVNLIGRLNNCGMVSTRFEVQLKDLEKPVNNLL<LSQQLGFTVLTTSVSIVDQQD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 97 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 80 .50 RPM |
| SRP007412_heart | 0 .03 RPM | 56 .78 RPM |
| SRP007412_kidney | 0 .00 RPM | 53 .23 RPM |
| SRP007412_liver | 0 .00 RPM | 40 .94 RPM |
| SRP007412_testis | 0 .00 RPM | 60 .70 RPM |