RetrogeneDB ID: | retro_mmus_827 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 11:99839975..99840260(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000082531 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Sumo2 | ||
Ensembl ID: | ENSMUSG00000020738 | ||
Aliases: | Sumo2, SUMO-2, Smt3A, Smt3b, Smt3h2 | ||
Description: | SMT3 suppressor of mif two 3 homolog 2 (yeast) [Source:MGI Symbol;Acc:MGI:2158813] |
Percent Identity: | 84.21 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINET |
.ADEKPK.GVKTENNDHINLKVAGQDG.VVQ.KIKR.T.LSKLMKAYCE.QGLS.RQIRF.FDGQPINET | |
Retrocopy | IADEKPKDGVKTENNDHINLKVAGQDGFVVQCKIKRRTSLSKLMKAYCEWQGLSKRQIRFWFDGQPINET |
Parental | DTPAQLEMEDEDTIDVFQQQTGGVY |
D...Q.E.EDED.IDVFQQQTGGVY | |
Retrocopy | DSLGQWEIEDEDMIDVFQQQTGGVY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 1 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .78 RPM |
SRP007412_heart | 0 .03 RPM | 0 .72 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .87 RPM |
SRP007412_liver | 0 .00 RPM | 0 .25 RPM |
SRP007412_testis | 0 .00 RPM | 1 .92 RPM |
TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
---|---|---|---|---|---|---|
no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
TSS #1 | TSS_20228 | 846 libraries | 204 libraries | 15 libraries | 5 libraries | 2 libraries |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000004724 | 1 retrocopy | |
Homo sapiens | ENSG00000188612 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000023769 | 3 retrocopies | |
Loxodonta africana | ENSLAFG00000025811 | 10 retrocopies | |
Monodelphis domestica | ENSMODG00000007222 | 11 retrocopies | |
Mus musculus | ENSMUSG00000020265 | 1 retrocopy | |
Mus musculus | ENSMUSG00000020738 | 19 retrocopies |
retro_mmus_1498, retro_mmus_1772, retro_mmus_1903, retro_mmus_2050, retro_mmus_2323, retro_mmus_2475, retro_mmus_2492, retro_mmus_2590, retro_mmus_2767, retro_mmus_2917, retro_mmus_2974, retro_mmus_3209, retro_mmus_3414, retro_mmus_3630, retro_mmus_415, retro_mmus_611, retro_mmus_689, retro_mmus_818, retro_mmus_827 ,
|
Mus musculus | ENSMUSG00000026021 | 5 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000028195 | 5 retrocopies | |
Pongo abelii | ENSPPYG00000029777 | 2 retrocopies |