RetrogeneDB ID: | retro_nleu_2410 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397353.1:2130414..2130849(+) | ||
Located in intron of: | ENSNLEG00000013319 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSNLEG00000027034 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.64 % |
Parental protein coverage: | 68.52 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | VANNFVTDKNSGE-VMTVGINAIKEITARCPLAMTEELLQDLAQYKTHKDKNVMMSARTLIQLFRTLNPQ |
VA.N.V...N.G..VMTVGIN.IK..T...P.....E...........K.KNV..SAR.LI..F...N.Q | |
Retrocopy | VASNSVKERNPGV<VMTVGINVIKKVTT*YPRIVIKEPAS-ISPRRIYKHKNVIISARILILFF*VPNSQ |
Parental | MLQKKFRGKPTEASIEARVQEYGELDAKDYIPGAEVL-EVEKEENAENDEEGWESTSISEEEDADGEWID |
.LQK.F.GKPTEAS.EARVQEYG.L.A.DYI.G...L.EV.K.EN..N..EGW.STS..EE.DA.G...D | |
Retrocopy | ILQKRFWGKPTEASTEARVQEYG*LNATDYISGGGIL<EV-KKENVVNRDEGWGSTSPEEEGDAHGGLVD |
Parental | VFHSS-DEEQQ |
..HSS..EEQQ | |
Retrocopy | MCHSS<CEEQQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000008521 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000008524 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000004811 | 2 retrocopies | |
Homo sapiens | ENSG00000198301 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000006441 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000012217 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000006682 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000017503 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000027034 | 1 retrocopy |
retro_nleu_2410 ,
|
Oryctolagus cuniculus | ENSOCUG00000026953 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014852 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000024399 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000022229 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000008974 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005270 | 1 retrocopy |