RetrogeneDB ID: | retro_pabe_2586 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 4:192772411..192772741(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GAR1 | ||
Ensembl ID: | ENSPPYG00000014996 | ||
Aliases: | None | ||
Description: | GAR1 ribonucleoprotein homolog (yeast) [Source:HGNC Symbol;Acc:14264] |
Percent Identity: | 93.64 % |
Parental protein coverage: | 50.69 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | NKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVK |
NKGQ.QGPPERVVL.GEFLHPCEDDIVC..TTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVK | |
Retrocopy | NKGQSQGPPERVVLIGEFLHPCEDDIVCEHTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVK |
Parental | LSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPP |
.SEN.KASSFKKL.KFYIDPYKLLPLQRFLPRPPGEKGPP | |
Retrocopy | MSENGKASSFKKL*KFYIDPYKLLPLQRFLPRPPGEKGPP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .41 RPM |
SRP007412_cerebellum | 0 .00 RPM | 5 .11 RPM |
SRP007412_heart | 0 .00 RPM | 4 .37 RPM |
SRP007412_kidney | 0 .00 RPM | 7 .76 RPM |
SRP007412_liver | 0 .00 RPM | 6 .79 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_2119 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000004605 | 2 retrocopies | |
Homo sapiens | ENSG00000109534 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000008681 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003776 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000021225 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000008615 | 2 retrocopies | |
Mus musculus | ENSMUSG00000028010 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016578 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000003901 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000004693 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000012089 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014996 | 1 retrocopy |
retro_pabe_2586 ,
|
Pan troglodytes | ENSPTRG00000016364 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013668 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000016318 | 1 retrocopy |