RetrogeneDB ID: | retro_ptro_1241 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 17:72026665..72026986(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POLR3K | ||
| Ensembl ID: | ENSPTRG00000007525 | ||
| Aliases: | None | ||
| Description: | DNA-directed RNA polymerase subunit [Source:UniProtKB/TrEMBL;Acc:H2QA65] |
| Percent Identity: | 77.78 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAEPCP |
| MLLF.PGC..GLIVEEGQRCHR.ACNTC..VH..T.KVTN.KY.KLKEVDD.LGGAAAWE.VDSTAEPCP | |
| Retrocopy | MLLFYPGCRDGLIVEEGQRCHRLACNTCLCVH-FTHKVTNWKYSKLKEVDDGLGGAAAWEDVDSTAEPCP |
| Parental | KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
| ..E.P.AY.M.LQT.SADEP.TTFY.CC.AQCGH.WRD | |
| Retrocopy | Q*EPPCAYYM*LQTHSADEPKTTFYQCCRAQCGHHWRD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 12 .74 RPM |
| SRP007412_cerebellum | 0 .11 RPM | 12 .80 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .90 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .74 RPM |
| SRP007412_liver | 0 .00 RPM | 9 .39 RPM |
| SRP007412_testis | 0 .84 RPM | 3 .16 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1861 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000019715 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011568 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000009989 | 2 retrocopies | |
| Felis catus | ENSFCAG00000009110 | 2 retrocopies | |
| Homo sapiens | ENSG00000161980 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000015593 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000013608 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002526 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007525 | 1 retrocopy |
retro_ptro_1241 ,
|
| Pteropus vampyrus | ENSPVAG00000000530 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007970 | 1 retrocopy |