RetrogeneDB ID: | retro_ptro_513 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 10:96874810..96875052(-) | ||
| Located in intron of: | ENSPTRG00000002806 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSPTRG00000016353 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
| Percent Identity: | 66.27 % |
| Parental protein coverage: | 70.09 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKT |
| M.Q..TYRRR......SN.TRLS.TPGNRIVYLY.KKVGKAPKS..GVCPGRL.G.RAVR.KV....SKT | |
| Retrocopy | MGQHVTYRRRPLVRN-SN*TRLS*TPGNRIVYLYAKKVGKAPKSSRGVCPGRLSGARAVRSKVVI**SKT |
| Parental | -KKHVSRAYGGSM |
| .K.HV.RA...S. | |
| Retrocopy | <KRHVYRACNASL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 97 .95 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 85 .36 RPM |
| SRP007412_heart | 0 .00 RPM | 66 .98 RPM |
| SRP007412_kidney | 0 .00 RPM | 223 .00 RPM |
| SRP007412_liver | 0 .03 RPM | 113 .88 RPM |
| SRP007412_testis | 0 .00 RPM | 50 .79 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_720 |
| Gorilla gorilla | retro_ggor_607 |