RetrogeneDB ID: | retro_mputfur_1305 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
Coordinates: | GL897075.1:2838977..2839202(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Gm2178 | ||
Ensembl ID: | ENSMPUG00000008873 | ||
Aliases: | None | ||
Description: | predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348] |
Percent Identity: | 65.33 % |
Parental protein coverage: | 61.48 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | KAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKA |
.A.KSACG.CPG.LRGV.AVRPKV.MRLS.TK.H..RA.GG.M..KCV.DRIK.AFL..EQK....V..A | |
Retrocopy | EAQKSACGWCPGQLRGVCAVRPKVCMRLSQTKIHICRA*GGFM*VKCVPDRIKCAFLTDEQKPIMEV*NA |
Parental | QAQSQ |
QA.S. | |
Retrocopy | QAESE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |