RetrogeneDB ID: | retro_ptro_701 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 12:72452722..72453091(+) | ||
Located in intron of: | ENSPTRG00000005230 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CHCHD3 | ||
Ensembl ID: | ENSPTRG00000019711 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.17 % |
Parental protein coverage: | 54.63 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | LTRAILRERISSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEE-RSSEFYRVTTEQYQKAAEEV |
L......ER.S.EEE..KAKHLA..L.E......KQ............E.R..EF..VTTEQYQKAA.E. | |
Retrocopy | LPMSFASERLSNEEEGCKAKHLAEHL-EEKDLVAKQQDAFYKEQLARLE>RGAEFHKVTTEQYQKAAKER |
Parental | EAKFKR-YESHPVCADLQAKILQCYRENTHQTLKCSALATQYMHCVNHAKQSMLEK |
.AKF....E..PVCADLQAKILQCY...THQTL...ALA.....CV..AKQ.MLEK | |
Retrocopy | AAKFSD<HEFCPVCADLQAKILQCYHHSTHQTLSGFALANV*VCCVHYAKQNMLEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .14 RPM |
SRP007412_cerebellum | 0 .07 RPM | 13 .19 RPM |
SRP007412_heart | 0 .00 RPM | 62 .43 RPM |
SRP007412_kidney | 0 .05 RPM | 38 .42 RPM |
SRP007412_liver | 0 .00 RPM | 25 .14 RPM |
SRP007412_testis | 0 .00 RPM | 13 .59 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000001312 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004942 | 1 retrocopy | |
Homo sapiens | ENSG00000106554 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000001671 | 1 retrocopy | |
Mus musculus | ENSMUSG00000053768 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000012967 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000014032 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025827 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000019711 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000013211 | 1 retrocopy | |
Sorex araneus | ENSSARG00000012111 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000022282 | 1 retrocopy |