RetrogeneDB ID: | retro_pvam_1488 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
Coordinates: | scaffold_993:80154..80584(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C18orf21 | ||
Ensembl ID: | ENSPVAG00000009174 | ||
Aliases: | None | ||
Description: | chromosome 18 open reading frame 21 [Source:HGNC Symbol;Acc:28802] |
Percent Identity: | 52.03 % |
Parental protein coverage: | 65.77 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | HYLEAAARKLQESCPGQARYLLWAYSSTHDAKSTF-EGTCPYCFQLLVLDNYRVRLKPKPKLTPRIQKLL |
H.........Q....GQAR...WA..S.H..KS...EG.CPY.FQL.VLD.....LKPKPKLTP.IQ.L. | |
Retrocopy | HVHAGSIAEAQDTRLGQAR-CFWAHGSSHTDKSFV<EGACPYQFQLQVLDKSGMCLKPKPKLTPKIQTLV |
Parental | NREARNYTLSFKEAKIVEKYKDSKSVLLITCKTCNRTV-KHHGKSRSFLSALKSNPTTPTSKLSLKTPER |
N.EA..Y.LSF.EAKI..K...S....L.T..TC.RTV.KH.GK.RSFLSA.....TTP.SK....T.ER | |
Retrocopy | N*EAKKYALSFREAKIM-KGEGSQTISLMTYQTCARTV<KHNGKRRSFLSAVRNKFTTPQSKPGQETLER |
Parental | KTLSSADL |
.T..SA.L | |
Retrocopy | PTPRSASL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000029548 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000021041 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000025449 | 1 retrocopy | |
Felis catus | ENSFCAG00000000626 | 1 retrocopy | |
Homo sapiens | ENSG00000141428 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000026334 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000018782 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000025605 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024273 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006237 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000028046 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000011163 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000009110 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000009973 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000009174 | 3 retrocopies |
retro_pvam_1086, retro_pvam_1488 , retro_pvam_629,
|
Tupaia belangeri | ENSTBEG00000016670 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000010817 | 2 retrocopies |