RetrogeneDB ID: | retro_sara_682 | ||
Retrocopy location | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | scaffold_258021:73093..73422(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CLNS1A | ||
| Ensembl ID: | ENSSARG00000009460 | ||
| Aliases: | None | ||
| Description: | chloride channel, nucleotide-sensitive, 1A [Source:HGNC Symbol;Acc:2080] |
| Percent Identity: | 59.13 % |
| Parental protein coverage: | 58.76 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LDGSGLGFSLEYPNISLHAVSRDLNAYPREHLYVMVNTKFGEE-VKESVSDEEEENSDDDDPIAEFRFVP |
| L.GSG...SL.YP..SLH.VSR.L..YPREHLYV.V....G.E..K....DEEE...D...P.A.FRFV. | |
| Retrocopy | LHGSGIEVSLDYPKVSLHVVSRNLITYPREHLYVIVSVTDG*E<IKR-ICDEEEGSDDNVEPSAKFRFVL |
| Parental | SDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQ |
| .DKS.LE..FTAMCECQ.LH.D...E..DD.DG.EYDV.AH.QGQ | |
| Retrocopy | IDKSTLEEIFTAMCECQDLHLD---EYLDDFDGKEYDVKAHGQGQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019930 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000004900 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014927 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000005260 | 1 retrocopy | |
| Felis catus | ENSFCAG00000026321 | 1 retrocopy | |
| Homo sapiens | ENSG00000074201 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000003091 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000005935 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000025439 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016699 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000024393 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003712 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000009460 | 2 retrocopies |
retro_sara_247, retro_sara_682 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000027980 | 3 retrocopies |