RetrogeneDB ID: | retro_tbel_210 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | GeneScaffold_1466:49004..49238(+) | ||
Located in intron of: | ENSTBEG00000005072 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MAGOHB | ||
Ensembl ID: | ENSTBEG00000014820 | ||
Aliases: | None | ||
Description: | mago-nashi homolog B (Drosophila) [Source:HGNC Symbol;Acc:25504] |
Percent Identity: | 84.62 % |
Parental protein coverage: | 68.42 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAMASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSE |
MAMAS.FYL.YY.GHKGK.GH.FLEFEF.PDGKLRYANNSNYKND.MIRKE.YVHKSV.EELKR.IDDS. | |
Retrocopy | MAMASNFYLCYYIGHKGKYGHKFLEFEF*PDGKLRYANNSNYKNDIMIRKETYVHKSVTEELKRTIDDSQ |
Parental | ITKEDDAL |
ITKEDD.L | |
Retrocopy | ITKEDDVL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000004382 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000021662 | 7 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000005997 | 4 retrocopies | |
Echinops telfairi | ENSETEG00000016591 | 3 retrocopies | |
Homo sapiens | ENSG00000111196 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000001782 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005082 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000462 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000003355 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000000548 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000004679 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000000835 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000011611 | 17 retrocopies | |
Tupaia belangeri | ENSTBEG00000014820 | 7 retrocopies |
retro_tbel_1250, retro_tbel_1393, retro_tbel_210 , retro_tbel_2259, retro_tbel_2723, retro_tbel_2878, retro_tbel_451,
|
Tarsius syrichta | ENSTSYG00000010452 | 7 retrocopies |