RetrogeneDB ID: | retro_tbel_3589 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | scaffold_145485:91514..91700(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HRSP12 | ||
Ensembl ID: | ENSTBEG00000002602 | ||
Aliases: | None | ||
Description: | heat-responsive protein 12 [Source:HGNC Symbol;Acc:16897] |
Percent Identity: | 82.26 % |
Parental protein coverage: | 63.27 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LGINPSSGQLVPGGVAEEAKQALINMGEILKAASCDYSNVVKTTVLLADINDFGTVNEIYKQ |
LGINPSSGQ.VPGGVAEEA.QALINM.E.LK.ASCD.S.VVKTTVLLA.INDF.TVN.IYK. | |
Retrocopy | LGINPSSGQFVPGGVAEEANQALINMDEVLKPASCD*STVVKTTVLLAYINDFRTVNKIYKE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000030250 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001278 | 8 retrocopies | |
Callithrix jacchus | ENSCJAG00000015560 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000025138 | 3 retrocopies | |
Erinaceus europaeus | ENSEEUG00000014805 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001185 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000002078 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000011825 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000006575 | 1 retrocopy | |
Mus musculus | ENSMUSG00000022323 | 1 retrocopy | |
Ornithorhynchus anatinus | ENSOANG00000021532 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000001465 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000011452 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000002602 | 10 retrocopies |
retro_tbel_1543, retro_tbel_1602, retro_tbel_2450, retro_tbel_2868, retro_tbel_2995, retro_tbel_3589 , retro_tbel_421, retro_tbel_621, retro_tbel_888, retro_tbel_953,
|