RetrogeneDB ID: | retro_vpac_531 | ||
Retrocopylocation | Organism: | Alpaca (Vicugna pacos) | |
Coordinates: | scaffold_33217:0..249(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF1AX | ||
Ensembl ID: | ENSVPAG00000009927 | ||
Aliases: | None | ||
Description: | eukaryotic translation initiation factor 1A, X-linked [Source:HGNC Symbol;Acc:3250] |
Percent Identity: | 92.77 % |
Parental protein coverage: | 59.85 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | KGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDI |
KGGKNRRRGKNEN.SEKRELVFK.DGQEYAQVIKMLGNGRLEA.CFDGVK.LCHIRGKLRKKVW.NTSDI | |
Retrocopy | KGGKNRRRGKNENKSEKRELVFKADGQEYAQVIKMLGNGRLEALCFDGVKMLCHIRGKLRKKVWVNTSDI |
Parental | ILVGLRD-QDNKA |
ILVGLRD.QDNKA | |
Retrocopy | ILVGLRDYQDNKA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000017633 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000005371 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000007518 | 3 retrocopies | |
Homo sapiens | ENSG00000173674 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000012977 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000027820 | 1 retrocopy | |
Mus musculus | ENSMUSG00000067194 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008182 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000020176 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000022504 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000005736 | 1 retrocopy | |
Sorex araneus | ENSSARG00000013528 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000010995 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000029864 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000002012 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000009927 | 4 retrocopies |