RetrogeneDB ID: | retro_btau_1439 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 5:94297489..94297805(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SLIRP | ||
Ensembl ID: | ENSBTAG00000008135 | ||
Aliases: | SLIRP, C10H14orf156 | ||
Description: | SRA stem-loop-interacting RNA-binding protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q32P59] |
Percent Identity: | 63.64 % |
Parental protein coverage: | 98.2 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | ASAARGAMALRTNIGRPVAFV-RKIPWTAASSELREHFAQFGHVRKCTVPFDKETGFHKGMGWIHFSSEE |
A.A.RGAM.L..N....VAFV..K.P.....SEL...FAQFG.V..CTVPFDK.TGFH.GMGWI.FSSE. | |
Retrocopy | ALAMRGAMVLCMNVHWLVAFV>EKFPGLWPPSEL---FAQFGQVPACTVPFDKKTGFHRGMGWIQFSSEK |
Parental | ELHNALQQENHVIDGVKLHVQPQRPKALQGDQTSDEEKDF |
E..N...QENHVI.G.K.HVQ.Q.PKALQ.DQTSDE.K.F | |
Retrocopy | EF-NT**QENHVIHGMKFHVQAQKPKALQRDQTSDEIKIF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .07 RPM | 14 .06 RPM |
ERP005899_muscle | 0 .00 RPM | 51 .10 RPM |
SRP017611_brain | 0 .09 RPM | 9 .32 RPM |
SRP017611_kidney | 0 .00 RPM | 24 .36 RPM |
SRP017611_liver | 0 .08 RPM | 10 .80 RPM |
SRP030211_testis | 0 .00 RPM | 32 .06 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003975 | 3 retrocopies | |
Bos taurus | ENSBTAG00000008135 | 3 retrocopies |
retro_btau_1439 , retro_btau_430, retro_btau_999,
|
Canis familiaris | ENSCAFG00000017230 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016946 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000001500 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007721 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000010345 | 4 retrocopies | |
Felis catus | ENSFCAG00000024050 | 2 retrocopies | |
Homo sapiens | ENSG00000119705 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011059 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000012080 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000029256 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021040 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006030 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000030691 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012314 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000028167 | 5 retrocopies | |
Tupaia belangeri | ENSTBEG00000013979 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000001781 | 2 retrocopies |