RetrogeneDB ID: | retro_amel_326 | ||
Retrocopy location | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192386.1:2976384..2976642(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SLIRP | ||
| Ensembl ID: | ENSAMEG00000003975 | ||
| Aliases: | None | ||
| Description: | SRA stem-loop interacting RNA binding protein [Source:HGNC Symbol;Acc:20495] |
| Percent Identity: | 63.74 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAASAVRGAVALRTSIRRPVAFVRKIPWTAASSELREHFAQFGHVRKCTVPFDKETGFHRGMGWVQFSSE |
| M...AVRG..ALR.....P..F........A.SEL.EHFAQFGHV.KCTVPFDKETGFHRGM.W.QFSS. | |
| Retrocopy | MVTLAVRGPRALRQGLD-PCGFCQEK--SLALSELKEHFAQFGHV*KCTVPFDKETGFHRGMDWTQFSS- |
| Parental | EELKNVLQQENHIVDGVKVNI |
| .ELKN..QQEN.I.DGVK..I | |
| Retrocopy | -ELKNAVQQENCIIDGVKLHI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003975 | 3 retrocopies |
retro_amel_307, retro_amel_326 , retro_amel_340,
|
| Bos taurus | ENSBTAG00000008135 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000017230 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016946 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000001500 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007721 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000010345 | 4 retrocopies | |
| Felis catus | ENSFCAG00000024050 | 2 retrocopies | |
| Homo sapiens | ENSG00000119705 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011059 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000012080 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000029256 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021040 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006030 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000030691 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012314 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000028167 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013979 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000001781 | 2 retrocopies |